SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330834866|ref|YP_004409594.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834866|ref|YP_004409594.1|
Domain Number 1 Region: 82-180
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000275
Family Multidrug resistance efflux transporter EmrE 0.025
Further Details:      
 
Weak hits

Sequence:  gi|330834866|ref|YP_004409594.1|
Domain Number - Region: 2-40
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0248
Family Multidrug resistance efflux transporter EmrE 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330834866|ref|YP_004409594.1|
Sequence length 182
Comment hypothetical protein Mcup_1005, partial [Metallosphaera cuprina Ar-4]
Sequence
MIYTQPIFVILFERILGAKVPTRAIVGVILGVLGLTLSITSASLDFGILIALMGGISWAI
GTVYYSRNLKSDDIAKLNAFMSLFSLPITLAITPLDFYFVFTPITLVLLITLGVLGQALG
YIFWFNAIREMGSIKASAGSLLVPIAAYVLSFLTIGAVPSFGEALGSFITLCGIFITVTS
RK
Download sequence
Identical sequences F4G2R2
gi|330834866|ref|YP_004409594.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]