SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330834932|ref|YP_004409660.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330834932|ref|YP_004409660.1|
Domain Number 1 Region: 11-67
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000215
Family Tetracyclin repressor-like, N-terminal domain 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330834932|ref|YP_004409660.1|
Sequence length 200
Comment TetR family transcriptional regulator [Metallosphaera cuprina Ar-4]
Sequence
MYDTYIILIMSRKISKDKIIKAAVSVFAEKGFDLATMDEIAKRSELSKGTIFLYFEKKDE
LIKQIAMLSIPYDVVEETLSGKYESAEEMLYDFGKKFMDKYKDSEMRSLLMMTIGNKRRY
EVIKSKLKSVCMDKIDEFFKKVEELSGVEIPFTLRRSFFGALLCYLIWWEDNPLDPEEYV
RQLSKTVLMSVRRERGDARS
Download sequence
Identical sequences F4G2X8
WP_013737674.1.2613 gi|330834932|ref|YP_004409660.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]