SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330835071|ref|YP_004409799.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835071|ref|YP_004409799.1|
Domain Number 1 Region: 85-483
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.01e-104
Family Amylase, catalytic domain 0.000000000049
Further Details:      
 
Domain Number 2 Region: 2-81
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000096
Family E-set domains of sugar-utilizing enzymes 0.0006
Further Details:      
 
Domain Number 3 Region: 488-552
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000000023
Family alpha-Amylases, C-terminal beta-sheet domain 0.00071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330835071|ref|YP_004409799.1|
Sequence length 560
Comment TreZ protein [Metallosphaera cuprina Ar-4]
Sequence
MFGPIQEDGKVRFRLWAPYCNEVKLRLNGSTYAMAKDERGYHEVELNAKEGDNYTFLTDL
GEVPDPASRYQPGGVHERSQLTSREFPWEDEGFKPSKNNLIIYELHVGTFSKEGTFNGVI
SKLDYLSDLGVTALELMPVAQFPGNRGWGYDGVYLYAVQNSYGGPQGLKRLVNEAHKRGL
SVILDVVYNHVGPEGNYMIKLGPYFSEKYKTPWGLTFNYDDRGSDEVRRFVLENVKYWID
EFHIDGFRLDAVHAIFDSSPKHILEEIAEVAHSRGRFVIAESDLNDPRIVNDKERCGYGI
DSQWVDDFHHSVHAYLTGERDGFYMDFGELRDISKALTDTFVYDGRYSKFRGKTHGRPIN
LPGGSFVIYIQDHDMVGNRGGGERLISLIDKDAYMIAAALYLLSPFIPMIFMGEEYGERN
PFLYFSDFSDPKLIEGVREGRKRENGQVRDPQSEETFLSSKLSFEVDQEILDTYKRLIEI
RKRFLDHERDLKVVVGEDWMILIKKRLLMMFAFKNSEIAVDQRGDLLLSSNPSFPPKLVS
GRYRLSKGFGVYLTSRGSNA
Download sequence
Identical sequences F4G3E5
gi|330835071|ref|YP_004409799.1| WP_013737813.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]