SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330835249|ref|YP_004409977.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835249|ref|YP_004409977.1|
Domain Number 1 Region: 3-159
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 4.48e-28
Family GHMP Kinase, N-terminal domain 0.0000745
Further Details:      
 
Domain Number 2 Region: 169-276
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 1.81e-21
Family Homoserine kinase 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|330835249|ref|YP_004409977.1|
Sequence length 312
Comment homoserine kinase [Metallosphaera cuprina Ar-4]
Sequence
MSMRVRAIAFSSSANLGAGYDVLSMSHRAFNDVVYAELLDSGEGKIFIETDSSVPTDPSK
NSASVPVEAIMEDYKIKGIIKLKIVKGIPPGLGLGSSGASAVAAVAAVSRLLDLNLSLED
IVKYAVLGEKAVSGSPHPDNVAASAFGGVVAVTSHDPFRIVRVAVNYDFKIMLIIPRLAT
GVGKTKRARELVPPKVELNKVVENARYLSSLMVGLIKGDRNLIQEGMNDSIVEKAREPLY
PYYPKIREISLKYNSVGVCVSGAGPSVLVLYDEETELEKIKLGATDVCRGFGFDCDFVTT
EIGGGVKVEGLD
Download sequence
Identical sequences F4FYJ5
gi|330835249|ref|YP_004409977.1| WP_013737991.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]