SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330835510|ref|YP_004410238.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835510|ref|YP_004410238.1|
Domain Number 1 Region: 21-207
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.03e-61
Family FAD-linked oxidases, N-terminal domain 0.0095
Further Details:      
 
Domain Number 2 Region: 213-442
Classification Level Classification E-value
Superfamily FAD-linked oxidases, C-terminal domain 3.92e-43
Family Vanillyl-alcohol oxidase-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330835510|ref|YP_004410238.1|
Sequence length 450
Comment D-lactate dehydrogenase (cytochrome) [Metallosphaera cuprina Ar-4]
Sequence
MEGFDLEKEMKELNLTTSKESREDFLSYKVKPGVIVYPRTEEEIVKVVDYANRKRIPIVT
WGAGTSLTGAVSCEGCILIDMKYMSSILEINDVDWYVRTQPGVNLEYLNKKLMERGFFLP
PDPASFFLCSVGGAVANSSGGMRGVKYGTFRDWVLALKVVLPTGEIVKIGEPLRKNRAGY
DLTHLFVGSEGTLGVITEIWFRIVPLPKRKLIPLLVSMPSLDSTAGVISDIRKSGIMPEI
AEFMDSEVLKTLNVHLNAGLKESEGGMLILLIEDQDLESIRNIIRKWDGDLTELSDKEWE
RVYSLRAQAAIALKASAKEMLVEDIVVPVSKLMDAIRKLKELEGKFNVRMPVIAHIGDGN
LHPNILLEEKEVALELFEKVGEIAIELGGSISGEHGIGVQKTKLMAIQLAKHNGVKVLEI
MKRIKEIIDPNDIMNPGKYVERAYNESMRN
Download sequence
Identical sequences F4FZZ2
WP_013738252.1.2613 gi|330835510|ref|YP_004410238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]