SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330835593|ref|YP_004410321.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835593|ref|YP_004410321.1|
Domain Number 1 Region: 142-243
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000131
Family Multidrug resistance efflux transporter EmrE 0.025
Further Details:      
 
Domain Number 2 Region: 29-99
Classification Level Classification E-value
Superfamily Multidrug resistance efflux transporter EmrE 0.0000000000353
Family Multidrug resistance efflux transporter EmrE 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330835593|ref|YP_004410321.1|
Sequence length 249
Comment hypothetical protein Mcup_1734 [Metallosphaera cuprina Ar-4]
Sequence
MSPLVIALIRVVVGGTILYLYVRKLEYGVKESISALLNIGIFLILLNLGIQYASNPGLAS
TLIYTQPVFVLVLSSLILKEKLNALQVLGTLVAFLGVLSTVGITGFNIGSLIALLGGFIW
ALGTLYYRIYLREKDVLALNSYMSLFSTLFILPISLTDFRIDPSIEGIGLALLVSITSQA
LGFILWFNAVKSIGPIKASTFVLLVPVSSYFFSYLILNEVPTISEVVGSAVTLLGVFLTF
LPGVLIKKA
Download sequence
Identical sequences F4G0F0
gi|330835593|ref|YP_004410321.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]