SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330835650|ref|YP_004410378.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835650|ref|YP_004410378.1|
Domain Number 1 Region: 10-250
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase NM domain-like 5.63e-68
Family Medium chain acyl-CoA dehydrogenase, NM (N-terminal and middle) domains 0.0000709
Further Details:      
 
Domain Number 2 Region: 238-392
Classification Level Classification E-value
Superfamily Acyl-CoA dehydrogenase C-terminal domain-like 9.99e-47
Family Medium chain acyl-CoA dehydrogenase-like, C-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330835650|ref|YP_004410378.1|
Sequence length 398
Comment acyl-CoA dehydrogenase domain-containing protein [Metallosphaera cuprina Ar-4]
Sequence
MVFPFKGLEDFKIDLSQDHEILRRSLREFLEREVKDKVEEGERKGDLLEVREKIKELGLN
GLDVSEEYGGASGDYLSLLVATEEMSRVWPSLSTFFLINWMFTSAILRFGSEDLKERYVV
PVARGERIAAFANTEPGAGTDVAGITSVAKEINGNYVINGRKIFITNGDLADYIILTART
SPISEPRWKGITMFIIERNYEGFKVEGRIDTTGLKASHTTEISLNEVKVPKENVVGKVGE
GFKYAVSSFDYARTIVAAQALGIAQAALEKMISYSLERKSFGQSIASFQMVQQKVSESMA
DVITSRLLVYWAGTLFKNKMENEYVMAASLAKFFATESAEKVVLRAMTAHGGYGVTTSTG
LERMLRDVQILKTYEGTNDIQRISAARHFYRKFMGINL
Download sequence
Identical sequences F4G0T5
gi|330835650|ref|YP_004410378.1| WP_013738392.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]