SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|330835783|ref|YP_004410511.1| from Metallosphaera cuprina Ar-4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330835783|ref|YP_004410511.1|
Domain Number 1 Region: 91-166
Classification Level Classification E-value
Superfamily Single hybrid motif 9.16e-22
Family Biotinyl/lipoyl-carrier proteins and domains 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|330835783|ref|YP_004410511.1|
Sequence length 167
Comment acetyl/propionyl-CoA carboxylase [Metallosphaera cuprina Ar-4]
Sequence
MKLYRVHSEVGDTFIIAQDQGQNKDKVKTENNEFEIEYVGQGRREGEIILRVNGEEHRAV
IDNGWIVLDNAKIFRAERITELPTQEGQSLEEMIKGKEGEVASPLQGRVVQIRVKEGDAV
NKGQPLLSIEAMKSETVISAPISGIVEKILVKSGQGVKKGDILIVIK
Download sequence
Identical sequences F4G1M0
gi|330835783|ref|YP_004410511.1| WP_013738525.1.2613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]