SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319897562|ref|YP_004135759.1| from Haemophilus influenzae F3031

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319897562|ref|YP_004135759.1|
Domain Number 1 Region: 20-496
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.79e-114
Family Pyridoxal-dependent decarboxylase 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|319897562|ref|YP_004135759.1|
Sequence length 511
Comment l-2,4-diaminobutyrate decarboxylase [Haemophilus influenzae F3031]
Sequence
MSNLKQHKQALFCNDNEAINDYETAMHNAVQAVSAWLKNEKMYTGGSIKQMRALISGFNP
TKEGMGVQKSLDHLVEIFLNPSLKVHHPHSLAHLHCPTMVTSQIAEVLINATNQSMDSWD
QSPAGSIMEEHLINWLRQKAGYGEGTSGVFTSGGTQSNLMGVLLARDWAIANHWKNEDGS
EWSVQRDGIPAEAMQKVKVICSENAHFSVQKNMAMMGMGFQSVVTVPSNANAQMDLIALK
QTLAQFKAEGKIAACIVATAGTTDAGAIDDLKAIRKLADEYQAWLHVDAAWGGALLLSKD
YRYFLDGIELTDSITLDFHKHFFQTISCGAFLLKDPANYRFIDYKADYLNSEYDEAHGVP
NLVAKSLQTTRRFDALKLWFTLEALGEDLYASMIDHGVKLTKEVEQYINDTPALEMLVPS
QFASVLFRVVPKDYPAEFIDALNQNVADELFARGEANIGVTKVGDKQSLKMTTLSPIATL
ENVKALLTQVLTEANRIKDDIKNGTYTPPID
Download sequence
Identical sequences E7A5V5
gi|319897562|ref|YP_004135759.1| WP_013526175.1.1036

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]