SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479171020|ref|YP_007799207.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479171020|ref|YP_007799207.1|
Domain Number 1 Region: 175-368
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.43e-43
Family ThiI-like 0.0000066
Further Details:      
 
Domain Number 2 Region: 4-174
Classification Level Classification E-value
Superfamily THUMP domain-like 2.79e-42
Family THUMP domain 0.00068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479171020|ref|YP_007799207.1|
Sequence length 399
Comment thiazole biosynthesis/tRNA modification protein ThiI [Faecalibacterium prausnitzii SL3/3]
Sequence
MKEIIMGYQGEMSLKGLNRNQFEAAMMKILRYRLKTVGKFKVYCTQSTFYMEPEEEDVDM
DLAFERVSKVFGLAALSRAVVCEKDFDTICQTAEDYLGSALHGIRTFKVEARRADKTYPM
TSPELMRELGAYLLGKHNYLKVDVHNPQFKVIVEIRDYGAYIHGPKIPGEGGLPVGTSGR
ALNMLSGGIDSPVAAYRMAKRGLALDHIHFASPPYTSERAKLKVKALAQLITVYTGSANL
FVVPYTKPQEYIRDNAPDVLFTVLMRRSMMRIANVIAKKQGCEALVTGESLAQVASQTVK
ALQCTDAAQDLPILRPLIGMDKTEIIETSRHINTFETSILPYEDCCTIFTPPHPKIRPEL
EEILAAEAAMPGLAALEAEAAEQTERIRVRITDQVEFEG
Download sequence
Identical sequences A0A173T1M0 D4K7K1
WP_015536741.1.34810 WP_015536741.1.86991 gi|479171020|ref|YP_007799207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]