SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479171690|ref|YP_007799877.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479171690|ref|YP_007799877.1|
Domain Number 1 Region: 85-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.05e-33
Family Ribosomal protein L6 0.0000945
Further Details:      
 
Domain Number 2 Region: 1-84
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.19e-23
Family Ribosomal protein L6 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479171690|ref|YP_007799877.1|
Sequence length 183
Comment LSU ribosomal protein L6P [Faecalibacterium prausnitzii SL3/3]
Sequence
MSRIGRKPIVIPAGVTVTVDEAAHTVAVKGPKGSLNSNYHPLMTVKVEGNEVLVTRPNDE
PKARSLHGLTRTNIANMVNGVVNGYEKKLEIVGVGMRCQKQGSNLVMNLGFSHQVNIPDT
EDCTIVWQDPNHFSVTGIDKQKVGQYAAEIRGKKPPEPYKGKGIRYAGEVVKHKEGKAGK
GKK
Download sequence
Identical sequences A0A2A7A9R8 A8S6Y8 D4K9H1
WP_005921858.1.86991 gi|479171690|ref|YP_007799877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]