SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479172395|ref|YP_007800582.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479172395|ref|YP_007800582.1|
Domain Number 1 Region: 6-86,208-422
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.57e-90
Family Bacterial dinuclear zinc exopeptidases 0.0024
Further Details:      
 
Domain Number 2 Region: 87-208
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 1.1e-29
Family Aminopeptidase/glucanase lid domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479172395|ref|YP_007800582.1|
Sequence length 438
Comment Aspartyl aminopeptidase [Faecalibacterium prausnitzii SL3/3]
Sequence
MIASEVREMLSFIDGNPTAYHTTAAVRDILLKAGFAELLESRKWALEPGKDYFVCRNGSS
IIAFRMGDQLENYSFNVAAAHTDSPCFRIKENAEIHMGQNYTKLNTEGYGGMICATWMDR
PLSVAGRVLVQENGAIVSRLVALDRDLLMIPSVAIHMNREVNDKASFNKQVDMLPVLGGA
CEEGALKKLIAEELQVSEEQILGSDLFLYVREKATVWGCNEEFISCGRLDDQQCVYGILK
GLLTAKNARSIGVAAFFDNEEVGSGTKQGAASTFLYDVLHRIAQSLGGNDEDFHRAVASS
FMVSADNAHAVHPNHPEHTDVNNCTYMNKGVVIKTHAGQKYTSDGMSVAAARELAARAGV
PLQYFANRSDKVGGSTLGNLAMAQVSMNCVDIGLPQLAMHSCYETAGAEDTLSLIKLMQE
LYSSHFEETAFGTLSISK
Download sequence
Identical sequences D4KBH6
gi|479172395|ref|YP_007800582.1| WP_015537756.1.86991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]