SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479172567|ref|YP_007800754.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479172567|ref|YP_007800754.1|
Domain Number 1 Region: 27-233
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.65e-51
Family PP-loop ATPase 0.00018
Further Details:      
 
Domain Number 2 Region: 377-460
Classification Level Classification E-value
Superfamily PheT/TilS domain 7.06e-20
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|479172567|ref|YP_007800754.1|
Sequence length 478
Comment tRNA(Ile)-lysidine synthetase, N-terminal domain/tRNA(Ile)-lysidine synthetase, C-terminal domain [Faecalibacterium prausnitzii SL3/3]
Sequence
MDTAILARVEDFCIREGLLQPGTPLQLAAAVSGGADSMALLLLLRQLQPRFGYTLSACHV
NHGLRGQSADRDEAFVRAECARLGVPLRVFHAAELTPPPAHAGEDWARRLRYTAFVQLQG
QGIDAIATAHTANDQAETLLLRLARGTGLHGAGGIRPRRGCYLRPLLCLSRAETEAVCRA
AGQTWVTDETNDTDAYARNRLRHSALPALKSTNAAAVQNLARFCEKAARADAYLAAGAAK
LLAAARLPGAEPAWQLLPLQAADPLLLETALHSLVAPVRDAEEKYVQLLCAVVRQGSGAV
QLTGQVRFCAGNGCLRQEMLPDALPRQLESAPQQVPLLPEKQPEFRLRGGWKGKAELLTA
DFEKKIQVVHKKDLKNRADYARITTLYTGLVLRARQPGDRFRPAGRGLSKPLRKWMNEAG
VPNELRDTLPLLASGSEILWVCGEGFADGLAPDTESRWILHLNAEIETQEEKTNEYAR
Download sequence
Identical sequences D4KBZ8
gi|479172567|ref|YP_007800754.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]