SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479172937|ref|YP_007801124.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479172937|ref|YP_007801124.1|
Domain Number 1 Region: 31-188
Classification Level Classification E-value
Superfamily Archaeal IMP cyclohydrolase PurO 5.1e-20
Family Archaeal IMP cyclohydrolase PurO 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479172937|ref|YP_007801124.1|
Sequence length 266
Comment Archaeal IMP cyclohydrolase [Faecalibacterium prausnitzii SL3/3]
Sequence
MEKINLNEYLAANEYPGRGIAVAMAPDGRQMFIGYFIMGRSENSRNRVFDPVPERGGICT
MAADPAKLEDPSLIIYNPVLTLGKTHIVTNGDQTDTIYDLMSQGKSFADALRTRTFEPDC
PNYTPRISAVVYADGSYQMSILKSADGNGDSVQRYFFDYPQPVAGEGHFISTYKHNGNPI
PSFEGEPLRFACPRTIGDFAHDMWSSLNVDNKVSLFARVIDLDTGESGDMIYNKYDSVCS
DLDDPEEPELLPEELELLKKLDAEEK
Download sequence
Identical sequences D4K572
gi|479172937|ref|YP_007801124.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]