SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479172835|ref|YP_007801022.1| from Faecalibacterium prausnitzii

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479172835|ref|YP_007801022.1|
Domain Number 1 Region: 207-396
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.41e-63
Family B3/B4 domain of PheRS, PheT 0.00000914
Further Details:      
 
Domain Number 2 Region: 38-198
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9.71e-36
Family Myf domain 0.0024
Further Details:      
 
Domain Number 3 Region: 475-698
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 7.95e-32
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00032
Further Details:      
 
Domain Number 4 Region: 706-803
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 8.11e-21
Family Anticodon-binding domain of PheRS 0.00062
Further Details:      
 
Domain Number 5 Region: 411-482
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000146
Family Domains B1 and B5 of PheRS-beta, PheT 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479172835|ref|YP_007801022.1|
Sequence length 803
Comment phenylalanyl-tRNA synthetase, beta subunit, non-spirochete bacterial [Faecalibacterium prausnitzii SL3/3]
Sequence
MKVPFSWLKEFVDIDVTAQELEEKLFSCGFEVEELIPLDAGISKVVVGKIVEMEKQEGTH
LTKCVVDCGAYGHEIRISTGAANMKLGDCVPTALDGSTLPGGITIKARKMQGVESNGMLC
SGAELGLNDDLFPGSEVYGLLILPEDSVPGTDIAPVVGLDDYIFDISITANRPDCQSVLG
IAREVAAVLGKPLHMPAMDYKAVCEPDAPITVKVEAPELCPRYMAHYVRNIRMGESPRWM
KRHLALCGLRSISNVVDITNHTLLEMGQPMHAFDLNKVAGRTIDVRRAHEGEKIVTLDEK
EFTLNPNNLVICDAEKPVALAGIMGGANSGMDDNTTSLLFECATFARDSVRKTSRALGQN
SDSSARYEKGVDRYSPQLGLARALHLIQQLDCGDITTLEYDLTDGRPLERKHIVATPAKI
CGVLGITVPDQTMIDILQRLEFTVDVQADGSWDVSAPLYRDDVESFPDLAEEVIREYGYD
HIVPTFLNTASVTNGGLNYDQKQQLKTKRLLAAQGFYEASTLAFYSNAELDMLHIPAEDE
ARKAIRILNPISENLSIMRTLLTPSMLNVIVDNLKKGNAEGRLFEMAPVYLAKELPINEH
PHERQTLCIGAFGPEEDFFTVKGALEALAAGFGLTFDYQRETAAWLHPGISAAVYCNGKR
LGVFGKLANEINAELEIAKEQKDSQNIYLGELDYEALMSCVEGELRYKPLSPYAPVKRDL
ALVCGEAVSCGEIEETIRKASPLVSEVKLFDIYRGANLGDGKKSMAFSLSLSDPKKEVSA
EEVERVVKKILGNLKFKLGIEIR
Download sequence
Identical sequences A0A2A7A793 A8SBJ4 D4KCR6
gi|479172835|ref|YP_007801022.1| WP_005924040.1.86991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]