SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313200805|ref|YP_004039463.1| from Methylovorus sp. MP688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313200805|ref|YP_004039463.1|
Domain Number 1 Region: 20-427
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 1.44e-71
Family Outer membrane efflux proteins (OEP) 0.00021
Further Details:      
 
Domain Number 2 Region: 479-583
Classification Level Classification E-value
Superfamily NTF2-like 0.00000000000029
Family SO0125-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313200805|ref|YP_004039463.1|
Sequence length 586
Comment TolC family type I secretion outer membrane protein [Methylovorus sp. MP688]
Sequence
MIVAAAIAAATPGMAAPASTLQEIVESAVTNNPEVQSRYHNYKAAEQEQNAARGGFLPKV
DLISSIRTQEKVFSNTNNTNIPDRQTQLVLKQMLFDGFATSNEVSRLGHAARVRYYELLS
AMQNTALETVKAYNDVLRYRQLVSYAEDNYIVHKQLFDKIEERVGAGVGRRVDLEQANGR
LALAEANLLTETTNLHDVTARFQRLVGDLPADTLSDVDYFKAGVEQSPSDALKLAYNQNP
DLLASIENIIATEDEVKTKKARYSPRLDLQGKKSLDVSSDGRNSTAAADYLELTLTFNLF
NGLTDKSLISQSVEKLNTSQDLRDKACVDTRQQLVIAYNDISQLKGQLDFRDQHQLSIEK
AREAYRRQFDIGQRTLLDLLDTENEYFQARRTYTNTERDLYNAYARTYASQGELLKKLNV
TRADVPELTPTDYNTYATCQAVAPEVVKIDKVALLAKARPLNTEPLKPAEVKFGEADLVK
STVNDWASAWQAKDYNRYISFYADSFVPEKGNRAAWLQQRKQRFAAPGAIVVELKDLKVS
MDGTQAQASVSFMQHYASGKYSDDTMKYLTLEKTNNRWLITKETSK
Download sequence
Identical sequences gi|313200805|ref|YP_004039463.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]