SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313201929|ref|YP_004040587.1| from Methylovorus sp. MP688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313201929|ref|YP_004040587.1|
Domain Number 1 Region: 33-163
Classification Level Classification E-value
Superfamily TPR-like 1.04e-24
Family Tetratricopeptide repeat (TPR) 0.0042
Further Details:      
 
Domain Number 2 Region: 289-395
Classification Level Classification E-value
Superfamily NTF2-like 6.32e-17
Family PA1314-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313201929|ref|YP_004040587.1|
Sequence length 400
Comment hypothetical protein MPQ_2203 [Methylovorus sp. MP688]
Sequence
MPALRTLPPLFVVLALILPVAAQADELKDISQLAQLGQAPQALTKLNAYIAKNPKSVDAL
FLRGVILTDSGKRDEAMKAFTEMTEKYPALPEPYNNLAVLYAERGEYDKARQALESAIKT
HPSYATAHENLGDIYARMASQAYDKALQLDNGNARPQSKLALIKSLSTSAPPTQLASQSN
SATSFTLAPAPLVNLGNGQVRALEQTKPVVKYEIPAKPDTPSRPASVVTEIKTPDAKPAA
PKPEMPAETPPKPTPVPPKTAETSKPAAEPTKPQDQAKSGSNKSAGNLDEQAIEQAVRQW
AKAWSDKNVPAYLASYGASFKTPDGQSRQEWEKTRKQRISAPASISVEVSNLRFKQDGDL
VRASFKQSYRAGGTAMRTSKTLVLKKGGNRWLIEQELTDR
Download sequence
Identical sequences gi|313201929|ref|YP_004040587.1| WP_013442973.1.53399

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]