SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313202070|ref|YP_004040728.1| from Methylovorus sp. MP688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313202070|ref|YP_004040728.1|
Domain Number 1 Region: 6-127
Classification Level Classification E-value
Superfamily NTF2-like 2.34e-22
Family ECA1476-like 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313202070|ref|YP_004040728.1|
Sequence length 127
Comment signal peptide protein [Methylovorus sp. MP688]
Sequence
MQTNDALKAQFTTSNQAWDSAFNSQQPALVASFYDDEASLLPSGAAQVTGGKAILEFWRD
LIGQGVVDHKLELLEVGADETLAFQRGRWSAAAVNAAGERQEFSGNVHLLYRRQADGSWK
LYTHTWN
Download sequence
Identical sequences C6XAA5
gi|254000110|ref|YP_003052173.1| gi|313202070|ref|YP_004040728.1| 582744.Msip34_2409 WP_013443114.1.53399 WP_013443114.1.76919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]