SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|313202149|ref|YP_004040807.1| from Methylovorus sp. MP688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313202149|ref|YP_004040807.1|
Domain Number 1 Region: 119-273
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.74e-35
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.015
Further Details:      
 
Domain Number 2 Region: 48-108
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000179
Family AraC type transcriptional activator 0.0042
Further Details:      
 
Domain Number 3 Region: 2-45
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000123
Family AraC type transcriptional activator 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|313202149|ref|YP_004040807.1|
Sequence length 273
Comment AraC family transcriptional regulator [Methylovorus sp. MP688]
Sequence
MLDHIEQHLDQSLSMDALCDIAGFSRFHFHRQFADYIGITVARYILLLRLRQASYQLAFD
PKVKVIDIALNAGFETPESFTRAFGNIFGQSPSAFRKNPDWEAWHVVYGFRLPEGNKIMQ
VEIVNVEATMIAVKEHRGAPDKLNHSVGDFIAWRKQTGSSPKNSSRTFGIAYDNPDTTEP
SAFRFDIAGEIKTDIAVNEQGIVVKSIPGGRCARVRHHGSHTRIGESIYPLYREWLPESG
EELRDFPLYFHYVNLLPDTPEAELITDIYLPLK
Download sequence
Identical sequences gi|313202149|ref|YP_004040807.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]