SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313202260|ref|YP_004040918.1| from Methylovorus sp. MP688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313202260|ref|YP_004040918.1|
Domain Number 1 Region: 32-156
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.00000262
Family Multidrug-binding domain of transcription activator BmrR 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|313202260|ref|YP_004040918.1|
Sequence length 177
Comment hypothetical protein MPQ_2540 [Methylovorus sp. MP688]
Sequence
MKKQLPIIFIAFILPITAMLWWWGLFSTPKLQIERAGDYHYAYLEAQGVYSKLGETLAEV
KQELDRQGISHGAEVTLVMTDPRKTKPADLLARTGYMIPADAKLQSPLKSATIPKREVVA
VSIKAHPLLAYGKTYGALLDYTNQHHSSLQLPTLEIFENSVLRVEMPLSHEPQDASP
Download sequence
Identical sequences WP_013443304.1.53399 gi|313202260|ref|YP_004040918.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]