SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313199888|ref|YP_004038546.1| from Methylovorus sp. MP688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313199888|ref|YP_004038546.1|
Domain Number 1 Region: 63-270
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.3e-31
Family Phosphate binding protein-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313199888|ref|YP_004038546.1|
Sequence length 367
Comment sulfonate ABC transporter periplasmic sulfonate-binding protein ssua [Methylovorus sp. MP688]
Sequence
MKVNVVYRLAILAASVAAFWAFVAQQAVAEEAPKVVRIAVVAYNLAGKTSYMGVDAVNNE
GGLEQSLAKKGIKLEWVPASHSGVGPIINEAFANGTIDFAAYGDLPPIILNAAKPVVQLV
APWGSNGNSYLVVPANSTAKSILDLKGKRIALHRGRPWEATFASLAASQGLTLKDFKIVN
VNPQVGAAALASGTVDGFFSLNDAYNLQDKGVGRIIWSTKTSLTDQKLRGGIWATNDFVN
KYPEITQLVVNAYVKTSYWASQEANRDKYIKDYLSQVQPESVVRRDYESDAVPWKDRWSP
VYDGVLTAHYQRLAAYAKSSGLIRNEVSVQQLLNPRFVNQALKDLGIEHYWVARSAPPPV
NVAQARN
Download sequence
Identical sequences C6X880
gi|253997814|ref|YP_003049877.1| 582744.Msip34_0101 gi|313199888|ref|YP_004038546.1| WP_013440936.1.53399 WP_013440936.1.76919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]