SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313202008|ref|YP_004040666.1| from Methylovorus sp. MP688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313202008|ref|YP_004040666.1|
Domain Number 1 Region: 23-248
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.75e-62
Family Phosphate binding protein-like 0.000000987
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313202008|ref|YP_004040666.1|
Sequence length 251
Comment molybdenum ABC transporter periplasmic molybdate-binding protein [Methylovorus sp. MP688]
Sequence
MKKMTFAWSLLAMLITSSALAEDKVTVFAAASLTNALADISAAYEKEKEAKVTQSYAASS
ALAKQIENGAPADIFISADTKWMDYLQDKKRIEAASRSNLLGNKVVLIAPKGRGFKVDFN
AGFDFAKAFDGRLCTGDVEAVPIGIYAKQALGNLNWWNSVKTRIVGAQDVRAALAFVARG
ECAAGIVYETDAKVSDKVEIVGVFPQDTHAPVVYPVARVAGAKNADSAFLTYLKSPFAAD
IFRKYGFTLLF
Download sequence
Identical sequences WP_013443052.1.53399 gi|313202008|ref|YP_004040666.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]