SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|313202281|ref|YP_004040939.1| from Methylovorus sp. MP688

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|313202281|ref|YP_004040939.1|
Domain Number 1 Region: 23-144
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000119
Family Phosphate binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|313202281|ref|YP_004040939.1|
Sequence length 157
Comment hypothetical protein MPQ_2561 [Methylovorus sp. MP688]
Sequence
MAVLALVFAGMLSMGQPLAGPADTLAVVVPKTQSGKIGSLVDLSLIYWRKKLYWSEGVRM
QPVNLPTDSPQRRQFSQRVLGSLPETQAEYWNEVYYHGTTPPHVVSSQEAVLRYVADTPG
GIGYVDACKVDSRVKAVAWLLGDGSFTTSPPALSCPP
Download sequence
Identical sequences gi|313202281|ref|YP_004040939.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]