SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332163015|ref|YP_004299592.1| from Yersinia enterocolitica subsp. palearctica 105.5R(r)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332163015|ref|YP_004299592.1|
Domain Number 1 Region: 3-363
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.01e-109
Family FMN-linked oxidoreductases 0.000000000569
Further Details:      
 
Domain Number 2 Region: 334-519
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 1.65e-40
Family N-terminal domain of adrenodoxin reductase-like 0.00000324
Further Details:      
 
Domain Number 3 Region: 461-528,567-651
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.56e-23
Family C-terminal domain of adrenodoxin reductase-like 0.000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332163015|ref|YP_004299592.1|
Sequence length 673
Comment 2,4-dienoyl-CoA reductase [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
Sequence
MLAYPHLLAPLNLGFTTLKNRVLMGSMHTGLEELPDGPQRLAAFYAERAAGGVGLIVTGG
IAPNKKGVVYQGASVLNDATQVPHHQIVTDAVHLAGGKIALQILHAGRYSYQKQPVAPSA
LQAPINPFAPQELSHDEVLQTIADFANCARLAKQAGYDGVEVMGSEGYLINQFLTARTNH
RNDEWGGDFTRRMRFAVEIVRAVREATGPDFILIYRLSMLDLVEDGSSWDEIEQLARAVE
QAGATLINTGIGWHEARIPTIATMVPRAGFSWVTRKLMGKVNIPLITTNRINNPAVAEQV
LTDGCADMVSMARPFLADAAFVQKAAQDRADEINTCIGCNQACLDQIFDGKLTSCLVNPR
ACRETEMPILPTETPKRLAVVGSGPAGLAFAVTAASRGHQVTLFDAATDIGGQFNIAKQI
PGKEEFYETLRYFRRQLVLHGVIQQLNTPVQPSQLADFDEIILACGIQPRLPAIKGIDHP
NVLTYLDVLRDKKPVGKRVAIIGAGGIGFDTAEYLSQSGDSSSLDSRAFSHEWGIDRDLA
HRGGLSPEGGKAHPSPREIFLLQRKTSKVGEGLGKTTGWIHRTSLAMRGVKMLNSVSYES
IDDEGLHIIRAEQASCLPVDTIIICAGQEPRRELHQPLLDMGKTVHLIGGADVAAELDAR
RAIDQGTRLALAI
Download sequence
Identical sequences WP_005163684.1.102102 WP_005163684.1.111 WP_005163684.1.12212 WP_005163684.1.16413 WP_005163684.1.16548 WP_005163684.1.18790 WP_005163684.1.19087 WP_005163684.1.20762 WP_005163684.1.22054 WP_005163684.1.24393 WP_005163684.1.2482 WP_005163684.1.26676 WP_005163684.1.2681 WP_005163684.1.27291 WP_005163684.1.2756 WP_005163684.1.29200 WP_005163684.1.32298 WP_005163684.1.33645 WP_005163684.1.33842 WP_005163684.1.34535 WP_005163684.1.36310 WP_005163684.1.37307 WP_005163684.1.37339 WP_005163684.1.37377 WP_005163684.1.3739 WP_005163684.1.41617 WP_005163684.1.42927 WP_005163684.1.4568 WP_005163684.1.46877 WP_005163684.1.50284 WP_005163684.1.50873 WP_005163684.1.52128 WP_005163684.1.52282 WP_005163684.1.54645 WP_005163684.1.56946 WP_005163684.1.57177 WP_005163684.1.59314 WP_005163684.1.60229 WP_005163684.1.6227 WP_005163684.1.6276 WP_005163684.1.64141 WP_005163684.1.6623 WP_005163684.1.67544 WP_005163684.1.68551 WP_005163684.1.7028 WP_005163684.1.70521 WP_005163684.1.74370 WP_005163684.1.75238 WP_005163684.1.75560 WP_005163684.1.75818 WP_005163684.1.77263 WP_005163684.1.78074 WP_005163684.1.78961 WP_005163684.1.78974 WP_005163684.1.79061 WP_005163684.1.79375 WP_005163684.1.81839 WP_005163684.1.8184 WP_005163684.1.82708 WP_005163684.1.82975 WP_005163684.1.83529 WP_005163684.1.84522 WP_005163684.1.84626 WP_005163684.1.8474 WP_005163684.1.85902 WP_005163684.1.86289 WP_005163684.1.91014 WP_005163684.1.92887 WP_005163684.1.94848 WP_005163684.1.96208 WP_005163684.1.9637 WP_005163684.1.96818 WP_005163684.1.99238 gi|332163015|ref|YP_004299592.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]