SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|330464836|ref|YP_004377737.1| from Verrucosispora maris AB-18-032

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|330464836|ref|YP_004377737.1|
Domain Number 1 Region: 135-225
Classification Level Classification E-value
Superfamily KorB DNA-binding domain-like 3.4e-18
Family KorB DNA-binding domain-like 0.0022
Further Details:      
 
Domain Number 2 Region: 33-160
Classification Level Classification E-value
Superfamily ParB/Sulfiredoxin 0.00000000384
Family ParB-like nuclease domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|330464836|ref|YP_004377737.1|
Sequence length 308
Comment putative plasmid partitioning protein [Verrucosispora maris AB-18-032]
Sequence
MAGKRINLSDLATEPALPEARLPAFAEAAPRTARVQQIAPNPLNTRDLESDRAKIESIAE
SMRTHGQLQPCAVVSREAFLHIYPEHEAAIGRALWVQVTGGRRRAAALAAGLPTLDIVVK
KEPAESRKAWVSATAAENLDRENLDPIEEARAIQLLVEECGSGKAAAEQMSRTPAWVTQR
LNLLKLAPEVQALVRTGEVPLREVRDLHQVALEKQLEELRLRREPQPHPPELTAVNSDPA
GPVAPTNEKTARPRRSGVTSAIKRLGGTPDRIAASLREELPEEDLQVLAHLLLNGTAAPP
NQGAGSRA
Download sequence
Identical sequences F4FI25
gi|330464836|ref|YP_004377737.1|NC_015409 gi|330464836|ref|YP_004377737.1| WP_013713111.1.26845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]