SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307721903|ref|YP_003893043.1| from Sulfurimonas autotrophica DSM 16294

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307721903|ref|YP_003893043.1|
Domain Number 1 Region: 50-518
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 4.97e-81
Family Nitrous oxide reductase, N-terminal domain 0.00000166
Further Details:      
 
Domain Number 2 Region: 479-651
Classification Level Classification E-value
Superfamily Cupredoxins 9.95e-26
Family Nitrosocyanin 0.0014
Further Details:      
 
Domain Number 3 Region: 766-862
Classification Level Classification E-value
Superfamily Cytochrome c 0.000000000000164
Family monodomain cytochrome c 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307721903|ref|YP_003893043.1|
Sequence length 867
Comment nitrous oxide reductase apoprotein [Sulfurimonas autotrophica DSM 16294]
Sequence
MATNISRLTSLLLGTSLAATMASANGGELEKVMKARGLTENDVIHAAKTYTPSGGRDEFM
IFSSGGQSGQIMVYGVPSMKILKYIGVFTPEPWQGYGYDEESKKVLREGNIRGREINWGD
THHPAISETNGVYDGKWLAINDKANPRIAILDLNDFETKQIVVNPVFKSDHGGAFFTPNS
EYILEASQYAAPFDNNYHPIEEYKETYRGGITFWKFNDKIGRINQKKSFVLELPPYMQDL
SDAGKGASNGWGFTNSFNSEMYTGGIEVGMPPFEAGCSRNDTDFLHVYNWKKLATLTKNK
KNYKVINGIKVIPMSVAVANNALFLIPEPKSPHGVDVSPDGEYIVVCGKLDTHASVYKWS
KIQKLIKDHKYAGKDPYGIPILSMKDSLHGQVELGLGPLHNQYGKHWKDGEIYTSLYVDS
QIVKWDYKHLKVLDKVNVHYNVGHLCGMEGKSADPQGKYIISLNKLAIDRFDPVGPLHPQ
NHQLIDISGKKMDLLYDMAIPLGEPHQAVAIRMSKLHPEVRYKMGTNSRTGKISKGKTLA
GQERVVRKGHNVTVYATLVRSHINPERVTVNKGDIVTFYLTNLERAEDETHGFTVDNYDV
HASLEPGKTASVKFKADLEGVFPYYCTEFCSALHLEMMGYLMVKDPNKKYVSAQKLKMKT
MSKAELKAEYDKTVAVNTATDAVIQSVVKFLKANHYEKYPTVKALVVDALDQYGKIPAQK
KLSDKAVKAGDLEKAVLFENMIWQYMVKTADVGIRAKNLLVKKVATKQSAAAAAGERAFG
EGGCGGCHVIGKVSSGPDLTGVLQRHENAEKWVRNFILNPKSKYHDPYVEGMINYFNLRM
PNQHMTKEEVNNIVEYFKWVDENANLF
Download sequence
Identical sequences E0URE5
gi|307721903|ref|YP_003893043.1| WP_013327784.1.28870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]