SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|78777964|ref|YP_394279.1| from Sulfurimonas denitrificans DSM 1251

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|78777964|ref|YP_394279.1|
Domain Number 1 Region: 49-515
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 2.88e-89
Family Nitrous oxide reductase, N-terminal domain 0.000000545
Further Details:      
 
Domain Number 2 Region: 476-655
Classification Level Classification E-value
Superfamily Cupredoxins 1.31e-26
Family Nitrosocyanin 0.0011
Further Details:      
 
Domain Number 3 Region: 767-859
Classification Level Classification E-value
Superfamily Cytochrome c 0.00000000000000362
Family monodomain cytochrome c 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|78777964|ref|YP_394279.1|
Sequence length 864
Comment nitrous-oxide reductase NosZ [Sulfurimonas denitrificans DSM 1251]
Sequence
MKKYLQIVYGALLGVLVIVQSATAESEFQKVMQKRGLSEKDALAALKVYNPSGKHDEYYA
FVSGGQSGQVMVYGIPSMRILKYIAVFAPEPWQGYGFDTDSKEILRQGNIRGREINWGDT
HHPALSESDGKYDGKYLFINDKANARIAVIDLKYFETSQIVVNPIFKSSHGGAFVTPNTD
YILESCQYAAPFTNDYYPMEAYEEVYRGGVTFWKFDKKNGKISQQDSFTLELPPYMQDLT
DAGKGISDGWAFTNSFNSELYTGGIEKGLPPFEAGCSRNDMDYLHVYNWKKLAELVKDDK
NVKVINGHRVIPIEIAVKNNALFLIPENKSPHGVDVNPDGQYIIVSGKLDTHASVYDFKK
ILKQIENKEFASKDSYGIPILDIKKSLHGQLELGLGHLHNTFGKEDGTIYSSLYVDSQVV
KWNYKQLKLLDRTNIHYNVGHLEAMEGKSADPQGEYLIALNKLSIDRFLPVGPLHPQNNQ
LIDIGGKKMELLVDMPVPLGEPHQAASIRASKIHTEVRYNMGTNSKTLKPHVGKTLAGQE
RIERKGNHVYIYSTMVRSHINPEHITLNKGDKVTMYITNLERAQDETHGFTIDHHNIHAS
VEPGESVQLDFVADIEGVFPYYCTEFCSALHIEMLGYMLVKDPNKDYGWIQKTKIKGLSK
EELQKEYEKILANNEATNSVIDSLFKFFEDRGYAKYPTVKNLVDDAKDQYTKIDSEREKA
TKAYNEKNLENAVLFENMVWQYMIKTADSAIRAKDLLVTNLATKKSAGAKKGEEVFHEGG
CSGCHVVGRVSSGPDLIGVLKRHRNAEKWVAEYIKNPESKFKEPYMERLIKFFNLKMPNQ
NMKDEEIKDIIEYFKWIDENADLF
Download sequence
Identical sequences Q30PN7
gi|78777964|ref|YP_394279.1| 326298.Suden_1770

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]