SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325113092|ref|YP_004277038.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325113092|ref|YP_004277038.1|
Domain Number 1 Region: 4-473
Classification Level Classification E-value
Superfamily ALDH-like 4.84e-149
Family ALDH-like 0.000000189
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325113092|ref|YP_004277038.1|
Sequence length 478
Comment succinate-semialdehyde dehydrogenase [Acidiphilium multivorum AIU301]
Sequence
MTLYASFGNFIDGAWQAGRAKLDVVSPATEKLLGTILAADTSDTQAALEAAARAKAPLRA
MGGFGRADAMHRIADAMLARTEEAQRMIATETGKPLAQAGREWGLACDQFRWFAEEARRI
YGRIVDSRVPGGRFEVTYEPVGVVGAFTAWNFPAALPARKLAPALAAGCPVVLRPSSQTP
GVAMIMVDCIRAGGLPNGAVNLVVGSTAATYAPIMADKRVRKVSLTGSTRVGQQMIRDAA
DTVKKVSMELGGNAPLIVYDDAELQHVLDMTVPTKFANCGQVCVTPDRIFVHDSLHDAFV
TGFVDRAKAIVLGDGLDPATTMGPLINARRLEDIDGVVQAAVKAGAKLAHGGRRSPTHNT
GHFYEPTVLTEVTDDMAVFAEENFGPVAAITRFTNEDEVLERANACDMGLSAYAFTRSAD
RARRTVAALKSGMVGINSFALAASEAPFGGTNHSGMGREGGTEGITDYLDTKLAQVVF
Download sequence
Identical sequences F0J729
gi|325113092|ref|YP_004277038.1| WP_013634932.1.41512 WP_013634932.1.96862 gi|325113092|ref|YP_004277038.1|NC_015178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]