SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325113269|ref|YP_004277215.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325113269|ref|YP_004277215.1|
Domain Number 1 Region: 8-85
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 1.89e-19
Family VCA0319-like 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325113269|ref|YP_004277215.1|
Sequence length 99
Comment hypothetical protein ACMV_P1_02770 [Acidiphilium multivorum AIU301]
Sequence
MATVAERKEYPISMRLPEADVAMIDRAASLRGRSRTDFVRDAAVRAAEEVVMEQGLIRMS
AEGFAEFMDVLARPAAPVPEMVEVLKRPAPWEPGYVAKR
Download sequence
Identical sequences A0A066PSN2 A0A257R124 A0A257S105 A5FTF4 F0J7K6 F7SBQ8
WP_007424913.1.19560 WP_007424913.1.41512 WP_007424913.1.67004 WP_007424913.1.88836 WP_007424913.1.96862 gi|148243788|ref|YP_001220028.1|NC_009467 gi|325113269|ref|YP_004277215.1|NC_015178 349163.Acry_3271 gi|148243788|ref|YP_001220028.1| gi|325113269|ref|YP_004277215.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]