SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325113272|ref|YP_004277218.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325113272|ref|YP_004277218.1|
Domain Number - Region: 29-64
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.01
Family CopG-like 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325113272|ref|YP_004277218.1|
Sequence length 70
Comment hypothetical protein ACMV_P1_02800 [Acidiphilium multivorum AIU301]
Sequence
MPNTRTAGDDASARYRRRQRARGATGVLVHLPNETISLIDTIKERKGLRSRGQALQQLIE
EWRAASPRTL
Download sequence
Identical sequences A0A066PL11 A0A257R227 A0A257S332 F0J7K9
gi|325113272|ref|YP_004277218.1| WP_013635078.1.41512 WP_013635078.1.67004 WP_013635078.1.88836 WP_013635078.1.96862 gi|325113272|ref|YP_004277218.1|NC_015178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]