SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325113295|ref|YP_004277240.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325113295|ref|YP_004277240.1|
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0000000000741
Family PutA pre-N-terminal region-like 0.07
Further Details:      
 
Weak hits

Sequence:  gi|325113295|ref|YP_004277240.1|
Domain Number - Region: 37-71
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease N-terminal domain-like 0.0141
Family tRNA-intron endonuclease N-terminal domain-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325113295|ref|YP_004277240.1|
Sequence length 74
Comment putative antitoxin [Acidiphilium multivorum AIU301]
Sequence
MLAVRLPPEIESRLDALAQATGRAKSFYVREAIMEHLDDLEDLYLAEQRLIDLRAGKTKT
VPLEDVMKRYGLED
Download sequence
Identical sequences F0J7V0
WP_013635097.1.41512 WP_013635097.1.96862 gi|325113295|ref|YP_004277240.1| gi|325113295|ref|YP_004277240.1|NC_015179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]