SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325113337|ref|YP_004277282.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325113337|ref|YP_004277282.1|
Domain Number - Region: 39-93
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0127
Family CopG-like 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325113337|ref|YP_004277282.1|
Sequence length 101
Comment hypothetical protein ACMV_P3_00600 [Acidiphilium multivorum AIU301]
Sequence
MSKRPAIDLAALTSEAARPMTEAVQRVPRPTPAAVPPPAPANAQHAAERPTRTANLQALA
FKVSPAFRKRFRQRAAAADLKLNELLFEALDAWEVQRGLKR
Download sequence
Identical sequences F0J7Z2
gi|325113337|ref|YP_004277282.1|NC_015179 gi|325113337|ref|YP_004277282.1| WP_013635138.1.41512 WP_013635138.1.96862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]