SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325168264|ref|YP_004277304.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325168264|ref|YP_004277304.1|
Domain Number 1 Region: 17-75
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.00000000000000612
Family CopG-like 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325168264|ref|YP_004277304.1|
Sequence length 77
Comment hypothetical protein ACMV_P6_00020 [Acidiphilium multivorum AIU301]
Sequence
MNKKVSFGVRPSVTRTSELDAEAWVADRATDEREPMKRLTIDIPAHLHRAIKTQCASRGT
KIADELRELLLQKYGKS
Download sequence
Identical sequences F0J858
gi|325168264|ref|YP_004277304.1| gi|325168264|ref|YP_004277304.1|NC_015181 WP_013635160.1.41512 WP_013635160.1.96862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]