SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325169006|ref|YP_004285752.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|325169006|ref|YP_004285752.1|
Domain Number - Region: 16-52
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0118
Family CopG-like 0.058
Further Details:      
 
Domain Number - Region: 41-85
Classification Level Classification E-value
Superfamily Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.0196
Family Mannose-6-phosphate receptor binding protein 1 (Tip47), C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325169006|ref|YP_004285752.1|
Sequence length 120
Comment plasmid conjugal transfer protein TraJ [Acidiphilium multivorum AIU301]
Sequence
MDTAYPRQIRSARETRTEIVRVRCTPSERKAIEELANVTGQSLSDFVRAGALSVDIRGRV
EQRAIYALADAVGHMNVLGAQLKQWQTARDGDDASAASAERVLADIEAAVRDVHEKVAAL
Download sequence
Identical sequences F0J7Z8
gi|325169006|ref|YP_004285752.1|NC_015188 gi|325169006|ref|YP_004285752.1| WP_013641272.1.41512 WP_013641272.1.96862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]