SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326402370|ref|YP_004282451.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326402370|ref|YP_004282451.1|
Domain Number 1 Region: 28-518
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-93
Family ALDH-like 0.0000000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326402370|ref|YP_004282451.1|
Sequence length 522
Comment aldehyde dehydrogenase [Acidiphilium multivorum AIU301]
Sequence
MTAEIDIAEGITLLGAGLVKTGGVAFHGRTAATGEPRAPGFGEAGAAEVALACARAEAAS
VAFADSTPEARAAFLEAAAANIMALGDRLVEAACAESGLPRGRIEGERGRTCGQLRMFAG
VLRAGRFADLRIDTAQPARQPLPRPDLRLRNIPLGPVAVFGASNFPLAFSVAGGDTASAL
AAGCPVVVKAHPAHPLTSALVGHAVADAVASCGLPEGVFTVLFGAGNELGGALVADPRIK
AVGFTGSRGGGLALAAIAARRKEPIPVYAEMSSINPVLLMPGALARRGAGLGTAFVGSLT
LGAGQFCTNPGLLLAIEGEGLQAFLDAARAGLAAAAAQTMLTGAIRSACERGIEARAAER
GVEEVARGPGGALFATDAATFLATPSLAEEIFGAAGILVRCRDAAELRQVIVGLEGQLTA
TLHLEPEDHAAARDLLPLLERKAGRILANGWPTGVEVCEAMVHGGPFPATTDSRTTSVGS
KAIERFLRPVCYQDLPADLLPTALADGNPLAMPRLVDGVMRD
Download sequence
Identical sequences A5FUZ3 F0J1Y3
gi|148259217|ref|YP_001233344.1| 349163.Acry_0197 WP_011941344.1.19560 WP_011941344.1.41512 WP_011941344.1.96862 gi|326402370|ref|YP_004282451.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]