SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326402456|ref|YP_004282537.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326402456|ref|YP_004282537.1|
Domain Number 1 Region: 17-93
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 1.67e-20
Family VCA0319-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326402456|ref|YP_004282537.1|
Sequence length 100
Comment hypothetical protein ACMV_03080 [Acidiphilium multivorum AIU301]
Sequence
MPIMNPAKQASAPSSRRDTLNLRIKSDDRGLIDRAAALTGKTKTDFVIDAARRAAEDALL
DRTLFLATPDAFDAFRARLDEPPLPNARLQRALKTTPPWE
Download sequence
Identical sequences F0J269
WP_013639295.1.19560 WP_013639295.1.41512 gi|326402456|ref|YP_004282537.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]