SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326403045|ref|YP_004283126.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326403045|ref|YP_004283126.1|
Domain Number 1 Region: 8-480
Classification Level Classification E-value
Superfamily ALDH-like 4.58e-168
Family ALDH-like 0.000000000811
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326403045|ref|YP_004283126.1|
Sequence length 487
Comment betaine aldehyde dehydrogenase [Acidiphilium multivorum AIU301]
Sequence
MTGEPRRNFIAGGPWSRAGLARFETRNPATGGVLAEIEIADAETVAAAVAAAREAQRAWA
ATPAAARGRILLRAASILRERNDELARTETLDTGRPIAETSVVDVISGAECLEYFGGLAA
SITGESVDLGPAAFGYTRREPLGVVAAIGAWNYPLQIACWKSAPALACGNAVIFKPAPQT
PLTAFELAAIYREAGLPDGLFNVVNGFGETGLALVRHPDVAKISLTGSVPTGKAVAAEAA
ASLKRVTLELGGKSPLIVCADADLDSAAAAAMLANFYSSGEICSNGTRVFVHRSVHDRFV
ETLAARAQRLVIGDPLDPATEIGALISPEHADRVMGFIEAGLREGARLVCGGKRRTEGVP
AGNTFIEPTIFAGCADGMTIAREEIFGPVMSVLAFDDEDDAIARANATPYGLAAAVFTRD
LARAHTLVARLEAGTCWINHYNITPIELPFGGMKQSGYGRENSRAAIDAYTEIKSVYVAL
APVDSPY
Download sequence
Identical sequences A5FX75 F0J5J5
gi|326403045|ref|YP_004283126.1| WP_011941909.1.19560 WP_011941909.1.41512 WP_011941909.1.96862 349163.Acry_0990 gi|148259999|ref|YP_001234126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]