SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|326403426|ref|YP_004283507.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|326403426|ref|YP_004283507.1|
Domain Number - Region: 13-59
Classification Level Classification E-value
Superfamily Urocanase 0.0209
Family Urocanase 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326403426|ref|YP_004283507.1|
Sequence length 160
Comment protein translocase subunit SecG [Acidiphilium multivorum AIU301]
Sequence
MITVLLVLQAFITIALIGVVLIQRSEGGGLGLGTSQGMGSFMTGRGTANLLTRVTAVLAT
LFMVLSLVLALLYRHGGGGSAESILNAPPPASPAKKAAPASPLAPLPPIPGESTPATTPP
AAPAPAAPNSAAPNTATPKPASPVPAPSKPAQSAPAPTRQ
Download sequence
Identical sequences A0A066PRM4 A5FXW6 F0IXW5
gi|148260240|ref|YP_001234367.1| WP_011942093.1.19560 WP_011942093.1.67004 WP_011942093.1.96862 gi|326403426|ref|YP_004283507.1| 349163.Acry_1237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]