SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326403442|ref|YP_004283523.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326403442|ref|YP_004283523.1|
Domain Number 1 Region: 16-456
Classification Level Classification E-value
Superfamily ALDH-like 5.76e-121
Family ALDH-like 0.0000000399
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|326403442|ref|YP_004283523.1|
Sequence length 471
Comment aldehyde dehydrogenase [Acidiphilium multivorum AIU301]
Sequence
MDMIETMMPDGVAGLDTLFARQQARAIALRSSGAEARIAKLRALEAAVQAWRPRLYAALQ
EDLGKPEAEADLSEILPVLSEIRHARRHLKSWMKPQRAAPTLTTFGTRARIRHEPRGVCL
IISPWNYPVNLALGPLASAIAAGNTAILKPSEMAPATSAALAAMLAEIFAPDEVAVREGD
AAIATALLDLPFDHIFFTGSPAIGKVVMTAAARHLSSVTLELGGKSPVIVDAGADLAKAA
KAIAWGKFTNCGQTCIAPDHLYAHEAVHDELVRRVRAETARMYGAAPGADYGRIVNERHF
DRILRLLDDARGRGATVEGGAADRARRLIAPAFVSGAPRESAVMQEEIFGPVLPVIRFRD
AAEPIEAINAAPKPLALYLFARDRRFTDRVIGETSSGGVGINTTMLHFLHGNLPFGGVNN
SGIGNAHGFYGFRAFSHERAVLRDVASATPMLFPPYTKRVRMMVKSVLRLA
Download sequence
Identical sequences A0A066PRX1 F0IXY1 F7SB81
WP_007424736.1.41512 WP_007424736.1.67004 WP_007424736.1.88836 WP_007424736.1.96862 gi|326403442|ref|YP_004283523.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]