SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326403935|ref|YP_004284017.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326403935|ref|YP_004284017.1|
Domain Number 1 Region: 18-502
Classification Level Classification E-value
Superfamily ALDH-like 8.64e-158
Family ALDH-like 0.00000000872
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|326403935|ref|YP_004284017.1|
Sequence length 510
Comment aldehyde dehydrogenase [Acidiphilium multivorum AIU301]
Sequence
MPDGAIRPSPGTAPGGFTFKPRYDNFIGGRFVAPAEGRYFANVTPVTGHAFTEVARSSEV
DIEHALDAAHAAAESWGRTAPAERALMLNRIADRMEENLALLAYVETVDNGKPIRETTAA
DIPLAIDHFRYFASCIRAQEGTLSEIDHNTVAYHFHEPLGVVGQIIPWNFPILMAAWKLA
PALAAGNCVVLKPAEQTPVSILVLAELIADLLPPGVLNIVNGFGLEAGKPLASSSRIAKI
AFTGETTTGRLIMQYASHNLIPVTLELGGKSPNIFFADVAAEDDDFLDKALEGFAMFALN
QGEVCTCPSRALIHESLYDRFMERAVPRVQAIRQGSPLDAATMVGAQASSEQVEKILSYL
DIGRQEGAEVLTGGGRAALGGELADGFYVQPTIFRGHNRMRIFQEEIFGPVVSVTTFKDE
AEALAIANDTLYGLGAGVWTRDANRAYRFGRGIKAGRVWTNCYHLYPAHAAFGGYKQSGI
GRETHRMMLDHYQQTKNMLVSYDPKKLGFF
Download sequence
Identical sequences A0A066PUL3 F0IZC5 F7S6K4
gi|326403935|ref|YP_004284017.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]