SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326404322|ref|YP_004284404.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326404322|ref|YP_004284404.1|
Domain Number 1 Region: 69-163
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.8e-34
Family Ribosomal protein L6 0.0000662
Further Details:      
 
Domain Number 2 Region: 3-68
Classification Level Classification E-value
Superfamily Ribosomal protein L6 0.00000000000000249
Family Ribosomal protein L6 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|326404322|ref|YP_004284404.1|
Sequence length 163
Comment 50S ribosomal protein L6 [Acidiphilium multivorum AIU301]
Sequence
MSITVVDGILTAKGKLGELKMPLSERVETVVEDGKVTVSPRDKEAASRMMWGTTRANVAN
MVQGVSQGYAKTLEINGTGFRAAVQGSNLVMNLGFSHDVVYPVPQGIKITCEKPTSIKVE
GIDKRLVGQVCAELRAFRPPEPYKGKGVKFEGEAIRRKEGKKK
Download sequence
Identical sequences F0J0G2
gi|326404322|ref|YP_004284404.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]