SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|326405169|ref|YP_004285251.1| from Acidiphilium multivorum AIU301

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|326405169|ref|YP_004285251.1|
Domain Number 1 Region: 28-430
Classification Level Classification E-value
Superfamily ALDH-like 7.46e-79
Family L-histidinol dehydrogenase HisD 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|326405169|ref|YP_004285251.1|
Sequence length 436
Comment histidinol dehydrogenase [Acidiphilium multivorum AIU301]
Sequence
MIRRLHTAEPGFAAALAALASDRASATDVAAPVAAIIARVRAEGDAALIDLTRRYDRFPI
TPETLRVSAAEIDAACARVGAEQLEAIDLAATRIEAFHRAQLPRDIGFTDAAGARLGLRW
GPLDAVGLYVPGGKASYPSSVLMNAIPARVAGVGRIAMCVPTPDGQMNDLVLAAAWRAGV
AEIYRVGGAQAVAALAYGTEAIAPVDRIVGPGNAFVAEAKRQVFGQVGIDSIAGPSEVLI
IADAGQDPWRVALDMIAQAEHDEAAQSLLVTDDAALAEAVAAELARALETLPRASIAAAS
LAAHGAIIIARDLDEAAEIANRVAPEHLQVMTADPDAVFARIRHAGAAFLGADAPTAIGD
YVAGPNHVLPTGGTARFSSGLSVFDFLKRTTFVALDPAAMASIGPAAATLAVAESLDGHA
RSIRARLTRNRAENLT
Download sequence
Identical sequences F0J522
gi|326405169|ref|YP_004285251.1| WP_013640960.1.41512 WP_013640960.1.96862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]