SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|428200746|ref|YP_007079335.1| from Pleurocapsa minor Pleurocapsa sp. PCC 7327

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|428200746|ref|YP_007079335.1|
Domain Number 1 Region: 4-118
Classification Level Classification E-value
Superfamily RbcX-like 1.44e-44
Family RbcX-like 0.0000132
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|428200746|ref|YP_007079335.1|
Sequence length 136
Comment RbcX protein [Pleurocapsa sp. PCC 7327]
Sequence
MYPKKIARDTAKVLQSYLTYQAVRTIIDQLSETNPTQAIWLSQYSSTNNIQDSEAYLEGL
MAENKELVLRIMTVREHLAETVLDFLPEMVRTGISQANMERRRQLLERLTQTQSTTSRPH
SESPDSEPNESSDSQP
Download sequence
Identical sequences K9T029
gi|428200746|ref|YP_007079335.1| WP_015142086.1.39153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]