SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352683689|ref|YP_004895673.1| from Acidaminococcus intestini RyC-MR95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352683689|ref|YP_004895673.1|
Domain Number 1 Region: 81-647
Classification Level Classification E-value
Superfamily Urocanase 3.27e-222
Family Urocanase 0.0000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|352683689|ref|YP_004895673.1|
Sequence length 682
Comment urocanate hydratase [Acidaminococcus intestini RyC-MR95]
Sequence
MKNADIAKAMTIKLEFPNGLPPKKPFQEGIRRAPDRGFRLSPAQTELALKNALRYIPEEY
HDELIPEFLEELTTRGRIYGYRFRPEGRIYGKPIDEYKGKCTEGKAFQVMIDNNLDFEVA
LYPYELVTYGETGSVCHDWMQYLLIKRYLEEMTQDQTLVMESGHPLGLFRSKPEAPRVII
SNGIMVGEYDNLHDWEIAEEMGVANYGQMTAGGWMYIGPQGIVHGTFNTILNAGRMKLGI
PEDGDLGGKLFVTSGLGGMSGAQGKAAIIANCAAIIAEVDASRIKTRLDQGWITGVSDSI
PEVIKLAQDAMAKKEGKAYAYHGNIVDLLEYIADHDVHVDLVSDQTSCHNVYDGGYCPQG
LTFEERTKMLAEDPKHFRELVDKTLHAHYNALKRITSKGIYFFDYGNSFMKAVFDSGVTE
ISKNGVDDKDGFIWPSYVEDIMGPQLFDYGYGPFRWVCLSGKPEDLHKTDMAAMSCIDPN
RRYQDRDNYIWIRDAEKNKMVVGTQARILYQDEIGRVNIALKFNELVRKGEIGPVMMGRD
HHDVSGTDSPFRETSNIKDGSNVMADMAVQTYAGNAARGMSLVALHNGGGVGIGKAINGG
FGLVLDGSHRVDEIIRSALSWDVMSGVARRSWARNEHAMETAVEFNGTRAGIGHLTIPYL
ADDKKVKEAVAKVYPTAHVIKD
Download sequence
Identical sequences C0WDY5 G4Q804 R6MFZ8 U2UQB8
gi|352683689|ref|YP_004895673.1| WP_009016136.1.13197 WP_009016136.1.48401 WP_009016136.1.72252 WP_009016136.1.80408 WP_009016136.1.85528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]