SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|352683734|ref|YP_004895718.1| from Acidaminococcus intestini RyC-MR95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352683734|ref|YP_004895718.1|
Domain Number 1 Region: 82-223
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 1.7e-26
Family L,D-transpeptidase catalytic domain-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|352683734|ref|YP_004895718.1|
Sequence length 224
Comment ErfK/YbiS/YcfS/YnhG family protein [Acidaminococcus intestini RyC-MR95]
Sequence
MNKQNRFFRHKGLAGALAMVAVILAVAFAAGYHLPDAAAKKGKETAALTETQKQMPQKAP
EPAISPEKAKEADRKESISLDASKSYHIIVEKKAHRLSLLLGDTVVRSYGCAIGKGGLGQ
KQRRGDNMTPVGTFTVDEIDDASSWPHDFGDGRGEIAGAYGPWFISLDTEALSGGAWDGI
GIHGTHDPQSIGTDASEGCIRLHNEDLQELRSVVKVGTVVEIKD
Download sequence
Identical sequences C0WEC3 G4Q8E9 R6N7K4
WP_009016274.1.13197 WP_009016274.1.72252 WP_009016274.1.80408 WP_009016274.1.85528 gi|352683734|ref|YP_004895718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]