SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352683842|ref|YP_004895826.1| from Acidaminococcus intestini RyC-MR95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352683842|ref|YP_004895826.1|
Domain Number 1 Region: 5-221
Classification Level Classification E-value
Superfamily YaeB-like 9.42e-67
Family YaeB-like 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|352683842|ref|YP_004895826.1|
Sequence length 229
Comment hypothetical protein Acin_0444 [Acidaminococcus intestini RyC-MR95]
Sequence
MEDQLTLSPVAYYEGPLTEKFGLPRQSGLVPEIEGTLVFTPPYRMREAFRGMEGFSHLWL
IWGFSKNHTWSPTVRPPRLGGNERLGVFATRAPFRPNPLGLSLVELVEIKDGGVKGLLLV
VRGADLMSGTPIYDIKPYIPYADARPQARSGFATGPDAELCVKCDEALLAPFTPTQRQAL
KKVLAQDPRPHYQHDAQRIYGMSFAGFDVHFRIDDRTVLVTDIRKGSSD
Download sequence
Identical sequences C0WC87 G4Q8Y8 R6M848
WP_009015538.1.13197 WP_009015538.1.72252 WP_009015538.1.85528 gi|352683842|ref|YP_004895826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]