SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352684669|ref|YP_004896654.1| from Acidaminococcus intestini RyC-MR95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352684669|ref|YP_004896654.1|
Domain Number 1 Region: 1-108
Classification Level Classification E-value
Superfamily YheA/YmcA-like 8.89e-29
Family YheA-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|352684669|ref|YP_004896654.1|
Sequence length 111
Comment hypothetical protein Acin_1289 [Acidaminococcus intestini RyC-MR95]
Sequence
MNVYDQMNQVCEAIRDSHEYKKMQEVKPKLAADKDAESMVKDFLKQKSEIELAQYQGKKP
DEAQVQKMQKLYEVLQLNPVASEYIQNYIRFQMMLGDLSKAFSDTIKEAVE
Download sequence
Identical sequences C0WBY3 G4Q8T1 R6M527 U2VMR9
WP_009015444.1.13197 WP_009015444.1.48401 WP_009015444.1.72252 WP_009015444.1.80408 WP_009015444.1.85528 gi|352684669|ref|YP_004896654.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]