SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|352683919|ref|YP_004895903.1| from Acidaminococcus intestini RyC-MR95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352683919|ref|YP_004895903.1|
Domain Number 1 Region: 1-239
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.03e-42
Family ADP-ribosylglycohydrolase 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|352683919|ref|YP_004895903.1|
Sequence length 269
Comment ADP-ribosylation/crystallin J1 [Acidaminococcus intestini RyC-MR95]
Sequence
MKGAFIGDIVGSRFEWTGFREKEFDLFAEGCRVTDDSLMTAAVAEAFLTMRETDLPETES
VLGPLLCERMRRLGRTYPDAGYGQKFKAWLMDETMGPYGSCGNGAAMRVSPAGWFAYTLA
EAEELALISCRVSHNEKSAEKAAQAVAGAIFLARSGARKDVIRTYLGRFYDLSEPFDELR
SHYEGEATCDGSVPQALTAFLASDSFEDALRRAVSLGGDTDTLAAISGSLAEPYFGIPAS
IYKIAEEYFTEEMKTVLQRFDALCEKEKD
Download sequence
Identical sequences C0WA60 G4Q3P0 R6M2Z9 U2TY84
WP_009014851.1.13197 WP_009014851.1.48401 WP_009014851.1.72252 WP_009014851.1.80408 WP_009014851.1.85528 gi|352683919|ref|YP_004895903.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]