SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|352685051|ref|YP_004897036.1| from Acidaminococcus intestini RyC-MR95

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|352685051|ref|YP_004897036.1|
Domain Number 1 Region: 14-180,538-739
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.07e-36
Family ABC transporter ATPase domain-like 0.031
Further Details:      
 
Domain Number 2 Region: 22-47,142-306
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000363
Family ABC transporter ATPase domain-like 0.086
Further Details:      
 
Domain Number 3 Region: 350-427
Classification Level Classification E-value
Superfamily Rad50 coiled-coil Zn hook 0.00000196
Family Rad50 coiled-coil Zn hook 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|352685051|ref|YP_004897036.1|
Sequence length 751
Comment hypothetical protein Acin_1682 [Acidaminococcus intestini RyC-MR95]
Sequence
MMQAFGPYADKETIDFTVLKNHQLFLITGPTGSGKTTILDAMTFALYGTASGDLRENRSL
RSDYASPKVKTEVQLVFTNQDRTYEVTRTPEQELVKQRGEGTRSVPAGACLVEIDDKGER
TLLASSYGAVTREVEAILGFKAAQFRQLMVLPQGEFRRFLMADSKERRIILETLFKTQAY
RKLEEALDARAKALKKDYEETAAQKTHLLEQAQTASLEELVQVLSENKRLLKEKEKEAAK
ANAVLKKATAALEGAKKQQVLFASYEAVCARRKALEKKEGSIESLKKKLKLLDEAQKLHA
PYDRAWQSLNRARQAEALEKEAEKDHGRALLEVTARSQKAAGTNTALLQEEVARAREELA
RMRAVSGEMVRLAGSLEKGKPCPVCGSLTHPHPATQTQEEKARLQKEQHDLEEKIAALKK
EQDALEKAQGALKKAAGSLETAKRSAREAHQALNQDKESFKKALEASSFPDQPAFLAAHH
DLAQKEAMQEEVTRFEAQKASTEGELKILQNEIRGKEKPLLAPFEEKEKAARSYYEALAT
QRGALGERIAREEKERDALKSLEEKIAKLQDDYGPIGLLAATAKGQNSENLSFSAYVLQS
ILDAVLKAANLRLSSISEGRYTLYRREGIYDARKEQGLDLEILDAYTGQARSVHTLSGGE
SFFTSLSLALGLSDVLESYAGGLHLDTILVDEGFGSLDPETLDKAMNTLMDLQKGGRLVG
IISHVAELKERIPAQLIVTGGVMGSHASFRV
Download sequence
Identical sequences G4Q390
gi|352685051|ref|YP_004897036.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]