SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|431801501|ref|YP_007228404.1| from Pseudomonas putida HB3267

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|431801501|ref|YP_007228404.1|
Domain Number 1 Region: 7-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 4.63e-28
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|431801501|ref|YP_007228404.1|
Sequence length 181
Comment cytochrome B561 [Pseudomonas putida HB3267]
Sequence
MVSSTPATHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSVERNLMKDLHFMLGLSVF
VLVWLRLAIRLSRPTPPIVPKPAAWQTGLAHLMHLALYLLMIILPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences A0A0P7CVV3 A0A136QMA0 A0A2A3M6U7 J8V0H9 L0FI97
gi|431801501|ref|YP_007228404.1| WP_003260150.1.32670 WP_003260150.1.41505 WP_003260150.1.57632 WP_003260150.1.61620 WP_003260150.1.71677 WP_003260150.1.92076 WP_003260150.1.9402 WP_003260150.1.95946 WP_003260150.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]